Recombinant Full Length Human EFCAB3 Protein, GST-tagged

• Cat.No.: EFCAB3-4176HF
• Product Overview: Human EFCAB3 full-length ORF (BAC05376.1, 1 a.a. - 438 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: EFCAB3 (EF-Hand Calcium Binding Domain 3) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is SPATA21.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 76.5 kDa
• Protein length: 438 amino acids
• AA Sequence: MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMAAFQDAYNFFYKDKTGCIDFHGLMCTVAKLGMNLTKHDVYNELKCADIDRDGKVNFSDFIKVLTDKNLFLKAVVPEKETCLDLAGNPGILLFEILSRLLETSALPRKSIIEIVSYFQRKFQHTGPGMLWSPYTMGYGKRTLKPDICTPPSSSMAAFANAARIATMKEKDLFKFLEELKRCNSGSDSPYSKIPIFPLFPNVDGVVMGKPFKDMQKLEMLRIKEPLHFFEDYFFHKRDWKTQAANIKSMDPASGYSNNIFTIDQMLKKKQTCTVADATAIKQHVKRATDTYNLGIALEHRKEMLNLWQKIRGDLIGMDSRNESFYDTFSTYTWSWNVCQELLSPKDLRLYDAYVNRNSSHNSRSSSSSDTSECYTDSGRKRKRKGLKGFQQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EFCAB3 EF-hand calcium binding domain 3 [ Homo sapiens ]
• Official Symbol: EFCAB3
• Synonyms: EFCAB3; EF-hand calcium binding domain 3; EF-hand calcium-binding domain-containing protein 3; FLJ25818; MGC126801; MGC126827
• Gene ID: 146779
• mRNA Refseq: NM_001144933
• Protein Refseq: NP_001138405
• MIM: 619567
• UniProt ID: Q8N7B9