Recombinant Full Length Human EFCAB3 Protein, GST-tagged

Cat.No. : EFCAB3-4176HF
Product Overview : Human EFCAB3 full-length ORF (BAC05376.1, 1 a.a. - 438 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 438 amino acids
Description : EFCAB3 (EF-Hand Calcium Binding Domain 3) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is SPATA21.
Molecular Mass : 76.5 kDa
AA Sequence : MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMAAFQDAYNFFYKDKTGCIDFHGLMCTVAKLGMNLTKHDVYNELKCADIDRDGKVNFSDFIKVLTDKNLFLKAVVPEKETCLDLAGNPGILLFEILSRLLETSALPRKSIIEIVSYFQRKFQHTGPGMLWSPYTMGYGKRTLKPDICTPPSSSMAAFANAARIATMKEKDLFKFLEELKRCNSGSDSPYSKIPIFPLFPNVDGVVMGKPFKDMQKLEMLRIKEPLHFFEDYFFHKRDWKTQAANIKSMDPASGYSNNIFTIDQMLKKKQTCTVADATAIKQHVKRATDTYNLGIALEHRKEMLNLWQKIRGDLIGMDSRNESFYDTFSTYTWSWNVCQELLSPKDLRLYDAYVNRNSSHNSRSSSSSDTSECYTDSGRKRKRKGLKGFQQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EFCAB3 EF-hand calcium binding domain 3 [ Homo sapiens ]
Official Symbol EFCAB3
Synonyms EFCAB3; EF-hand calcium binding domain 3; EF-hand calcium-binding domain-containing protein 3; FLJ25818; MGC126801; MGC126827;
Gene ID 146779
mRNA Refseq NM_001144933
Protein Refseq NP_001138405
MIM 619567
UniProt ID Q8N7B9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EFCAB3 Products

Required fields are marked with *

My Review for All EFCAB3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon