Recombinant Full Length Human EDN2 Protein, GST-tagged

• Cat.No.: EDN2-4192HF
• Product Overview: Human EDN2 full-length ORF ( AAH34393, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the endothelin protein family of secretory vasoconstrictive peptides. The preproprotein is processed to a short mature form which functions as a ligand for the endothelin receptors that initiate intracellular signaling events. This gene product is involved in a wide range of biological processes, such as hypertension and ovulation. Altered expression of this gene is implicated in tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 45.32 kDa
• Protein length: 178 amino acids
• AA Sequence: MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EDN2 endothelin 2 [ Homo sapiens ]
• Official Symbol: EDN2
• Synonyms: EDN2; endothelin 2; endothelin-2; ET2; ET-2; preproendothelin 2; preproendothelin-2; PPET2
• Gene ID: 1907
• mRNA Refseq: NM_001956
• Protein Refseq: NP_001947
• MIM: 131241
• UniProt ID: P20800