Recombinant Full Length Human EDN2 Protein, GST-tagged
Cat.No. : | EDN2-4192HF |
Product Overview : | Human EDN2 full-length ORF ( AAH34393, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 178 amino acids |
Description : | This gene encodes a member of the endothelin protein family of secretory vasoconstrictive peptides. The preproprotein is processed to a short mature form which functions as a ligand for the endothelin receptors that initiate intracellular signaling events. This gene product is involved in a wide range of biological processes, such as hypertension and ovulation. Altered expression of this gene is implicated in tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Molecular Mass : | 45.32 kDa |
AA Sequence : | MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EDN2 endothelin 2 [ Homo sapiens ] |
Official Symbol | EDN2 |
Synonyms | EDN2; endothelin 2; endothelin-2; ET2; ET-2; preproendothelin 2; preproendothelin-2; PPET2; |
Gene ID | 1907 |
mRNA Refseq | NM_001956 |
Protein Refseq | NP_001947 |
MIM | 131241 |
UniProt ID | P20800 |
◆ Recombinant Proteins | ||
EDN2-3055H | Recombinant Human EDN2 Protein, GST-tagged | +Inquiry |
EDN2-4203C | Recombinant Chicken EDN2 | +Inquiry |
EDN2-12283H | Recombinant Human EDN2, GST-tagged | +Inquiry |
EDN2-2027H | Recombinant Human EDN2 Protein (Gln32-Arg178), N-His tagged | +Inquiry |
EDN2-7557H | Recombinant Human EDN2, His-tagged | +Inquiry |
◆ Native Proteins | ||
EDN2-8310H | Native Human EDN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDN2-6720HCL | Recombinant Human EDN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDN2 Products
Required fields are marked with *
My Review for All EDN2 Products
Required fields are marked with *
0
Inquiry Basket