Recombinant Full Length Human Ectonucleoside Triphosphate Diphosphohydrolase 7(Entpd7) Protein, His-Tagged
Cat.No. : | RFL15726HF |
Product Overview : | Recombinant Full Length Human Ectonucleoside triphosphate diphosphohydrolase 7(ENTPD7) Protein (Q9NQZ7) (1-604aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-604) |
Form : | Lyophilized powder |
AA Sequence : | MARISFSYLCPASWYFTVPTVSPFLRQRVAFLGLFFISCLLLLMLIIDFRHWSASLPRDR QYERYLARVGELEATDTEDPNLNYGLVVDCGSSGSRIFVYFWPRHNGNPHDLLDIKQMRD RNSQPVVKKIKPGISAMADTPEHASDYLRPLLSFAAAHVPVKKHKETPLYILCTAGMRLL PERKQLAILADLVKDLPLEFDFLFSQSQAEVISGKQEGVYAWIGINFVLGRFDHEDESDA EATQELAAGRRRTVGILDMGGASLQIAYEVPTSTSVLPAKQEEAAKILLAEFNLGCDVQH TEHVYRVYVTTFLGFGGNFARQRYEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGL TDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNSEFYGFSE FFYCTEDVLRIGGRYHGPTFAKAAQDYCGMAWSVLTQRFKNGLFSSHADEHRLKYQCFKS AWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAILYKTRFLPLRDLRQEGVRQAHG SWFRLSFVYNHYLFFACILVVLLAIFLYLLRLRRIHHRQTRASAPLDLLWLEEVVPMMGV QVGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ENTPD7 |
Synonyms | ENTPD7; LALP1; Ectonucleoside triphosphate diphosphohydrolase 7; NTPDase 7; Lysosomal apyrase-like protein 1 |
UniProt ID | Q9NQZ7 |
◆ Recombinant Proteins | ||
SENP2-14879M | Recombinant Mouse SENP2 Protein | +Inquiry |
GTF2H4-1829R | Recombinant Rhesus Macaque GTF2H4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25713CF | Recombinant Full Length Innexin-3(Inx-3) Protein, His-Tagged | +Inquiry |
TEP1-9127M | Recombinant Mouse TEP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PARL-394H | Recombinant Human PARL Full Length Transmembrane protein, Myc-tagged | +Inquiry |
◆ Native Proteins | ||
Plg-5465R | Native Rat Plasminogen | +Inquiry |
a-Thrombin-97H | Native Human a-Thrombin | +Inquiry |
IgM-04T | Native Toxoplasma gondii IgM antigen, RH strain | +Inquiry |
AMY1A-8022H | Native Human Salivary Amylase | +Inquiry |
Complement C3c-49H | Native Human Complement C3c | +Inquiry |
◆ Cell & Tissue Lysates | ||
EVC-577HCL | Recombinant Human EVC cell lysate | +Inquiry |
RPL10L-1538HCL | Recombinant Human RPL10L cell lysate | +Inquiry |
Lung-518D | Dog Lung Lysate, Total Protein | +Inquiry |
MOB2-772HCL | Recombinant Human MOB2 cell lysate | +Inquiry |
TOE1-874HCL | Recombinant Human TOE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENTPD7 Products
Required fields are marked with *
My Review for All ENTPD7 Products
Required fields are marked with *
0
Inquiry Basket