Recombinant Full Length Human ECHDC1 Protein, GST-tagged

• Cat.No.: ECHDC1-4163HF
• Product Overview: Human ECHDC1 full-length ORF ( AAH03549.1, 1 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 301 amino acids
• Description: ECHDC1 (Ethylmalonyl-CoA Decarboxylase 1) is a Protein Coding gene. Among its related pathways are Fatty Acid Biosynthesis (WikiPathways) and Propanoate metabolism. GO annotations related to this gene include carboxy-lyase activity and methylmalonyl-CoA decarboxylase activity.
• Molecular Mass: 59.4 kDa
• AA Sequence: MAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIAKKGKFNK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ECHDC1 enoyl CoA hydratase domain containing 1 [ Homo sapiens ]
• Official Symbol: ECHDC1
• Synonyms: ECHDC1; enoyl CoA hydratase domain containing 1; enoyl Coenzyme A hydratase domain containing 1; ethylmalonyl-CoA decarboxylase; dJ351K20.2; methylmalonyl-CoA decarboxylase; enoyl-CoA hydratase domain-containing protein 1; MMCD; FLJ40827; DKFZp762M1110
• Gene ID: 55862
• mRNA Refseq: NM_001002030
• Protein Refseq: NP_001002030
• MIM: 612136
• UniProt ID: Q9NTX5