Recombinant Human ECHDC1 protein, GST-tagged
Cat.No. : | ECHDC1-3746H |
Product Overview : | Recombinant Human ECHDC1 protein(170-301 aa), fused to GST tag, was expressed in E. coli. |
Availability | March 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 170-301 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | PESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIAKKGKFNK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ECHDC1 enoyl CoA hydratase domain containing 1 [ Homo sapiens ] |
Official Symbol | ECHDC1 |
Synonyms | ECHDC1; enoyl CoA hydratase domain containing 1; enoyl Coenzyme A hydratase domain containing 1; ethylmalonyl-CoA decarboxylase; dJ351K20.2; methylmalonyl-CoA decarboxylase; enoyl-CoA hydratase domain-containing protein 1; MMCD; FLJ40827; DKFZp762M1110; |
Gene ID | 55862 |
mRNA Refseq | NM_001002030 |
Protein Refseq | NP_001002030 |
MIM | 612136 |
UniProt ID | Q9NTX5 |
◆ Recombinant Proteins | ||
ECHDC1-2302H | Recombinant Human ECHDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ECHDC1-3032H | Recombinant Human ECHDC1 Protein, GST-tagged | +Inquiry |
Echdc1-2717M | Recombinant Mouse Echdc1 Protein, Myc/DDK-tagged | +Inquiry |
ECHDC1-4966M | Recombinant Mouse ECHDC1 Protein | +Inquiry |
ECHDC1-2002R | Recombinant Rat ECHDC1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECHDC1-526HCL | Recombinant Human ECHDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ECHDC1 Products
Required fields are marked with *
My Review for All ECHDC1 Products
Required fields are marked with *
0
Inquiry Basket