Recombinant Full Length Human DYRK3 Protein, GST-tagged

• Cat.No.: DYRK3-4092HF
• Product Overview: Human DYRK3 full-length ORF ( AAH15501, 1 a.a. - 568 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 88.22 kDa
• Protein length: 568 amino acids
• AA Sequence: MKWKEKLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVHKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS
• Applications: Kinase Assay
  Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DYRK3 dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [ Homo sapiens ]
• Official Symbol: DYRK3
• Synonyms: DYRK3; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3; dual specificity tyrosine-phosphorylation-regulated kinase 3; dual specificity tyrosine (Y) phosphorylation regulated kinase 5; hYAK3 2; protein kinase Dyrk3; RED; REDK; regulatory erythroid kinase; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 5; DYRK5; hYAK3-2
• Gene ID: 8444
• mRNA Refseq: NM_001004023
• Protein Refseq: NP_001004023
• MIM: 603497
• UniProt ID: O43781