Recombinant Full Length Human DUSP22 Protein, GST-tagged

• Cat.No.: DUSP22-4104HF
• Product Overview: Human DUSP22 full-length ORF ( NP_064570.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DUSP22 (Dual Specificity Phosphatase 22) is a Protein Coding gene. Diseases associated with DUSP22 include Alk-Negative Anaplastic Large Cell Lymphoma and Lymphatic System Cancer. GO annotations related to this gene include phosphatase activity and protein tyrosine/serine/threonine phosphatase activity. An important paralog of this gene is DUSP15.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 47.3 kDa
• Protein length: 184 amino acids
• AA Sequence: MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DUSP22 dual specificity phosphatase 22 [ Homo sapiens ]
• Official Symbol: DUSP22
• Synonyms: DUSP22; dual specificity phosphatase 22; dual specificity protein phosphatase 22; JKAP; JSP1; MKPX; VHX; JSP-1; MKP-x; LMW-DSP2; MAP kinase phosphatase x; JNK-stimulating phosphatase 1; JNK-stimulatory phosphatase-1; mitogen-activated protein kinase phosphatase x; low molecular weight dual specificity phosphatase 2; homolog of mouse dual specificity phosphatase LMW-DSP2; LMWDSP2; FLJ35864
• Gene ID: 56940
• mRNA Refseq: NM_020185
• Protein Refseq: NP_064570
• MIM: 616778
• UniProt ID: Q9NRW4