Recombinant Full Length Human DUSP22 Protein, GST-tagged

Cat.No. : DUSP22-4104HF
Product Overview : Human DUSP22 full-length ORF ( NP_064570.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 184 amino acids
Description : DUSP22 (Dual Specificity Phosphatase 22) is a Protein Coding gene. Diseases associated with DUSP22 include Alk-Negative Anaplastic Large Cell Lymphoma and Lymphatic System Cancer. GO annotations related to this gene include phosphatase activity and protein tyrosine/serine/threonine phosphatase activity. An important paralog of this gene is DUSP15.
Molecular Mass : 47.3 kDa
AA Sequence : MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUSP22 dual specificity phosphatase 22 [ Homo sapiens ]
Official Symbol DUSP22
Synonyms DUSP22; dual specificity phosphatase 22; dual specificity protein phosphatase 22; JKAP; JSP1; MKPX; VHX; JSP-1; MKP-x; LMW-DSP2; MAP kinase phosphatase x; JNK-stimulating phosphatase 1; JNK-stimulatory phosphatase-1; mitogen-activated protein kinase phosphatase x; low molecular weight dual specificity phosphatase 2; homolog of mouse dual specificity phosphatase LMW-DSP2; LMWDSP2; FLJ35864;
Gene ID 56940
mRNA Refseq NM_020185
Protein Refseq NP_064570
MIM 616778
UniProt ID Q9NRW4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DUSP22 Products

Required fields are marked with *

My Review for All DUSP22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon