Recombinant Full Length Human DUPD1 Protein, GST-tagged

• Cat.No.: DUPD1-4085HF
• Product Overview: Human DUPD1 full-length ORF ( NP_001003892.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DUPD1 (Dual Specificity Phosphatase And Pro Isomerase Domain Containing 1) is a Protein Coding gene. Diseases associated with DUPD1 include Cervix Carcinoma. GO annotations related to this gene include phosphatase activity and protein tyrosine/serine/threonine phosphatase activity. An important paralog of this gene is DUSP13.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 51.7 kDa
• Protein length: 220 amino acids
• AA Sequence: MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DUPD1 dual specificity phosphatase and pro isomerase domain containing 1 [ Homo sapiens ]
• Official Symbol: DUPD1
• Synonyms: DUPD1; dual specificity phosphatase and pro isomerase domain containing 1; dual specificity phosphatase DUPD1; DUSP27; dual specificity phosphatase 27; atypical dual-specific protein phosphatase; FMDSP
• Gene ID: 338599
• mRNA Refseq: NM_001003892
• Protein Refseq: NP_001003892
• MIM: 618574
• UniProt ID: Q68J44