Recombinant Full Length Human DUB3 Protein, GST-tagged

• Cat.No.: DUB3-4081HF
• Product Overview: Human DUB3 partial ORF ( NP_958804, 431 a.a. - 530 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 431-530 amino acids
• Description: DUB3 is a member of the ubiquitin processing protease (UBP) subfamily of deubiquitinating enzymes. See USP1 (MIM 603478) for background information.[supplied by OMIM, Mar 2008]
• Molecular Mass: 36.74 kDa
• AA Sequence: ESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHPEQQSSLLNLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: USP17L2 ubiquitin specific peptidase 17-like family member 2 [ Homo sapiens (human) ]
• Official Symbol: DUB3
• Synonyms: USP17L2; ubiquitin specific peptidase 17-like family member 2; Ubiquitin Specific Peptidase 17-Like Family Member 2; Ubiquitin-Specific-Processing Protease 17-Like Protein 2; Ubiquitin Carboxyl-Terminal Hydrolase 17-Like Protein 2; Deubiquitinating Enzyme 17-Like Protein 2; Ubiquitin Thioesterase 17-Like Protein 2; Ubiquitin Specific Peptidase 17-Like 2; Deubiquitinating Protein 3; Deubiquitinating Enzyme 3; DUB-3; USP17; DUB3; Ubiquitin Thiolesterase 17-Like Protein 2; Ubiquitin Carboxyl-Terminal Hydrolase 17; EC 3.4.19.12; EC 3.1.2.15; USP17L; USP17H; USP17I; USP17J; USP17K; USP17M; ubiquitin carboxyl-terminal hydrolase 17; deubiquitinating enzyme 17-like protein 2; deubiquitinating enzyme 3; deubiquitinating protein 3; ubiquitin carboxyl-terminal hydrolase 17-like protein 2; ubiquitin specific peptidase 17-like 2; ubiquitin thioesterase 17-like protein 2; ubiquitin thiolesterase 17-like protein 2; ubiquitin-specific-processing protease 17-like protein 2; EC 3.4.19.12
• Gene ID: 377630
• mRNA Refseq: NM_201402
• Protein Refseq: NP_958804
• MIM: 610186
• UniProt ID: Q6R6M4