Recombinant Full Length Human DSCC1 Protein, C-Flag-tagged
Cat.No. : | DSCC1-2044HFL |
Product Overview : | Recombinant Full Length Human DSCC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | CHTF18 (MIM 613201), CHTF8 (MIM 613202), and DSCC1 are components of an alternative replication factor C (RFC) (see MIM 600404) complex that loads PCNA (MIM 176740) onto DNA during S phase of the cell cycle. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.6 kDa |
AA Sequence : | MKRTRDEVDATLQIAKLNAAELLPAVHCLGFGPGASGAAAGDFCLLELEPTLCQQLEDGHSLVIRGDKDE QAVLCSKDKTYDLKIADTSNMLLFIPGCKTPDQLKKEDSHCNIIHTEIFGFSNNYWELRRRRPKLKKLKK LLMENPYEGPDSQKEKDSNSSKYTTEDLLDQIQASEEEIMTQLQVLNACKIGGYWRILEFDYEMKLLNHV TQLVDSESWSFGKVPLNTCLQELGPLEPEEMIEHCLKCYGKKYVDEGEVYFELDADKICRAAARMLLQNA VKFNLAEFQEVWQQSVPEGMVTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTE EDIAPYIQDLCGEKQTIGALLTKYSRSSMQNGVKVYNSRRPIS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | DSCC1 DNA replication and sister chromatid cohesion 1 [ Homo sapiens (human) ] |
Official Symbol | DSCC1 |
Synonyms | DCC1 |
Gene ID | 79075 |
mRNA Refseq | NM_024094.3 |
Protein Refseq | NP_076999.2 |
MIM | 613203 |
UniProt ID | Q9BVC3 |
◆ Recombinant Proteins | ||
DSCC1-2055H | Recombinant Human DSCC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DSCC1-2387H | Recombinant Human DSCC1 Protein, GST-tagged | +Inquiry |
DSCC1-2797HF | Recombinant Full Length Human DSCC1 Protein, GST-tagged | +Inquiry |
DSCC1-791H | Recombinant Human DSCC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DSCC1-1174H | Recombinant Human DSCC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DSCC1-6812HCL | Recombinant Human DSCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DSCC1 Products
Required fields are marked with *
My Review for All DSCC1 Products
Required fields are marked with *
0
Inquiry Basket