Recombinant Full Length Human DRD2 Protein

• Cat.No.: DRD2-6910HF
• Product Overview: Recombinant Human full-length DRD2, fused without tag, was expressed in wheat germ.

Specification

• Description: This gene encodes the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative splicing of this gene results in two transcript variants encoding different isoforms. A third variant has been described, but it has not been determined whether this form is normal or due to aberrant splicing.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 48.73 kDa
• Protein length: 443 amino acids
• AA Sequence: MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVS LAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKR RVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNT KRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQML AIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
• Applications: Antibody Production; Functional Study; Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: DRD2 dopamine receptor D2 [ Homo sapiens (human) ]
• Official Symbol: DRD2
• Synonyms: DRD2; dopamine receptor D2; D2R; D2DR; D(2) dopamine receptor; dopamine D2 receptor; dopamine receptor D2 isoform; seven transmembrane helix receptor
• Gene ID: 1813
• mRNA Refseq: NM_000795
• Protein Refseq: NP_000786
• MIM: 126450
• UniProt ID: P14416