Recombinant Full Length Human DPPA2 Protein, GST-tagged

Cat.No. : DPPA2-4149HF
Product Overview : Human DPPA2 full-length ORF ( AAH18070.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 298 amino acids
Description : DPPA2 (Developmental Pluripotency Associated 2) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and chromatin binding. An important paralog of this gene is DPPA4.
Molecular Mass : 60.2 kDa
AA Sequence : MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DPPA2 developmental pluripotency associated 2 [ Homo sapiens ]
Official Symbol DPPA2
Synonyms DPPA2; developmental pluripotency associated 2; developmental pluripotency-associated protein 2; cancer/testis antigen 100; CT100; PESCRG1; embryonic stem cell (ESC) associated transcript 15-2; pluripotent embryonic stem cell-related gene 1 protein; ECAT15-2;
Gene ID 151871
mRNA Refseq NM_138815
Protein Refseq NP_620170
MIM 614445
UniProt ID Q7Z7J5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DPPA2 Products

Required fields are marked with *

My Review for All DPPA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon