Recombinant Full Length Human DPPA2 Protein, GST-tagged

• Cat.No.: DPPA2-4149HF
• Product Overview: Human DPPA2 full-length ORF ( AAH18070.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 298 amino acids
• Description: DPPA2 (Developmental Pluripotency Associated 2) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and chromatin binding. An important paralog of this gene is DPPA4.
• Molecular Mass: 60.2 kDa
• AA Sequence: MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DPPA2 developmental pluripotency associated 2 [ Homo sapiens ]
• Official Symbol: DPPA2
• Synonyms: DPPA2; developmental pluripotency associated 2; developmental pluripotency-associated protein 2; cancer/testis antigen 100; CT100; PESCRG1; embryonic stem cell (ESC) associated transcript 15-2; pluripotent embryonic stem cell-related gene 1 protein; ECAT15-2
• Gene ID: 151871
• mRNA Refseq: NM_138815
• Protein Refseq: NP_620170
• MIM: 614445
• UniProt ID: Q7Z7J5