Recombinant Full Length Human DNASE1L2 Protein, GST-tagged

• Cat.No.: DNASE1L2-4034HF
• Product Overview: Human DNASE1L2 full-length ORF (BAG53566.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DNASE1L2 (Deoxyribonuclease 1 Like 2) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding and deoxyribonuclease activity. An important paralog of this gene is DNASE1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 59.3 kDa
• Protein length: 299 amino acids
• AA Sequence: MGGPRALLAALWALEAAGTAALRIGAFNIQSFGDSKVSDPACGSIIAKILAGYDLALVQEVRDPDLSAVSALMEQINSVSEHEYSFVSSQPLGRDQYKEMYLFVYRKDAVSVVDTYLYPDPEDVFSREPFVVKFSAPGTGERAPPLPSRRALTPPPLPAAAQNLVLIPLHAAPHQAVAEIDALYDVYLDVIDKWGTDDMLFLGDFNADCSYVRAQDWAAIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVACGARLRRSLKPQSATVHDFQEEFGLDQTQALAISDHFPVEVTLKFHR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNASE1L2 deoxyribonuclease I-like 2 [ Homo sapiens ]
• Official Symbol: DNASE1L2
• Synonyms: DNAS1L2
• Gene ID: 1775
• mRNA Refseq: NM_001374
• Protein Refseq: NP_001365
• MIM: 602622
• UniProt ID: Q92874