Recombinant Full Length Human DNAJC3 Protein, C-Flag-tagged
Cat.No. : | DNAJC3-1765HFL |
Product Overview : | Recombinant Full Length Human DNAJC3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.4 kDa |
AA Sequence : | MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDN YIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENE EKEAQSQLIKSDEMQRLRSQALNAFGSGDYTAAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISD LKAASKLKNDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIR DGRYTDATSKYESVMKTEPSIAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAY LIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHRSWNSWQGFNP FSSGGPFRFKFHFN myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | DNAJC3 DnaJ heat shock protein family (Hsp40) member C3 [ Homo sapiens (human) ] |
Official Symbol | DNAJC3 |
Synonyms | P58; HP58; ACPHD; ERdj6; PRKRI; P58IPK; p58(IPK) |
Gene ID | 5611 |
mRNA Refseq | NM_006260.5 |
Protein Refseq | NP_006251.1 |
MIM | 601184 |
UniProt ID | Q13217 |
◆ Recombinant Proteins | ||
DNAJC3-1822C | Recombinant Chicken DNAJC3 | +Inquiry |
DNAJC3-1296R | Recombinant Rhesus monkey DNAJC3 Protein, His-tagged | +Inquiry |
DNAJC3-2387H | Recombinant Human DNAJC3 Protein, MYC/DDK-tagged | +Inquiry |
DNAJC3-1121R | Recombinant Rhesus Macaque DNAJC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC3-3799H | Recombinant Human DNAJC3 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAJC3 Products
Required fields are marked with *
My Review for All DNAJC3 Products
Required fields are marked with *
0
Inquiry Basket