Recombinant Full Length Human DNAJB9 Protein, GST-tagged

• Cat.No.: DNAJB9-3987HF
• Product Overview: Human DNAJB9 full-length ORF ( NP_036460.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 223 amino acids
• Description: This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized to the endoplasmic reticulum. This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis. [provided by RefSeq, Dec 2010]
• Molecular Mass: 51.9 kDa
• AA Sequence: MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNAJB9 DnaJ (Hsp40) homolog, subfamily B, member 9 [ Homo sapiens ]
• Official Symbol: DNAJB9
• Synonyms: DNAJB9; DnaJ (Hsp40) homolog, subfamily B, member 9; MDG1; dnaJ homolog subfamily B member 9; endoplasmic reticulum DnaJ homolog 4; microvascular endothelial differentiation gene 1 protein; ERdj4; MDG-1; MST049; MSTP049; DKFZp564F1862
• Gene ID: 4189
• mRNA Refseq: NM_012328
• Protein Refseq: NP_036460
• MIM: 602634
• UniProt ID: Q9UBS3