Recombinant Full Length Human DNAAF2 Protein, GST-tagged

• Cat.No.: DNAAF2-4044HF
• Product Overview: Human DNAAF2 full-length ORF ( AAH11400.1, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a highly conserved protein involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 57.8 kDa
• Protein length: 280 amino acids
• AA Sequence: MGGPGTKSGEPLCPPLLCNQDKETLTLLIQVPRIQPQSLQGDLNPLWYKLRFSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLELQECSNSDQLQGKEERVNEESHLTEKEYIEHCNTPTTDSDSSIAVKALQIDSFGLVTCFQQESLDVSQMILGKSQQPESKMQSEFIKEKSATCSNEEKDNLNESVITEEKETDGDHLSSLLNKTTVHNIPGFDSIKETNMQDGSVQVIKDHVTNCAFSFQNSLLYDLD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNAAF2 dynein, axonemal, assembly factor 2 [ Homo sapiens ]
• Official Symbol: DNAAF2
• Synonyms: DNAAF2; dynein, axonemal, assembly factor 2; C14orf104, chromosome 14 open reading frame 104; protein kintoun; CILD10; FLJ10563; kintoun; KTU; PF13; dynein assembly factor 2, axonemal; C14orf104
• Gene ID: 55172
• mRNA Refseq: NM_001083908
• Protein Refseq: NP_001077377
• MIM: 612517
• UniProt ID: Q9NVR5