Recombinant Full Length Human DNAAF2 Protein, GST-tagged

Cat.No. : DNAAF2-4044HF
Product Overview : Human DNAAF2 full-length ORF ( AAH11400.1, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 280 amino acids
Description : This gene encodes a highly conserved protein involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]
Molecular Mass : 57.8 kDa
AA Sequence : MGGPGTKSGEPLCPPLLCNQDKETLTLLIQVPRIQPQSLQGDLNPLWYKLRFSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLELQECSNSDQLQGKEERVNEESHLTEKEYIEHCNTPTTDSDSSIAVKALQIDSFGLVTCFQQESLDVSQMILGKSQQPESKMQSEFIKEKSATCSNEEKDNLNESVITEEKETDGDHLSSLLNKTTVHNIPGFDSIKETNMQDGSVQVIKDHVTNCAFSFQNSLLYDLD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNAAF2 dynein, axonemal, assembly factor 2 [ Homo sapiens ]
Official Symbol DNAAF2
Synonyms DNAAF2; dynein, axonemal, assembly factor 2; C14orf104, chromosome 14 open reading frame 104; protein kintoun; CILD10; FLJ10563; kintoun; KTU; PF13; dynein assembly factor 2, axonemal; C14orf104;
Gene ID 55172
mRNA Refseq NM_001083908
Protein Refseq NP_001077377
MIM 612517
UniProt ID Q9NVR5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DNAAF2 Products

Required fields are marked with *

My Review for All DNAAF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon