Recombinant Full Length Human DLX1 Protein, GST-tagged
Cat.No. : | DLX1-4000HF |
Product Overview : | Human DLX1 full-length ORF ( NP_835221.2, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 255 amino acids |
Description : | This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 53.7 kDa |
AA Sequence : | MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DLX1 distal-less homeobox 1 [ Homo sapiens ] |
Official Symbol | DLX1 |
Synonyms | DLX1; distal-less homeobox 1; Distal-Less Homeobox 1; Distal-Less Homeo Box 1; homeobox protein DLX-1; distal-less homeo box 1 |
Gene ID | 1745 |
mRNA Refseq | NM_001038493 |
Protein Refseq | NP_001033582 |
MIM | 600029 |
UniProt ID | P56177 |
◆ Recombinant Proteins | ||
DLX1-212C | Recombinant Cynomolgus Monkey DLX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DLX1-466C | Recombinant Cynomolgus DLX1 Protein, His-tagged | +Inquiry |
DLX1-281H | Recombinant Human DLX1 Protein, His-tagged | +Inquiry |
DLX1-4000HF | Recombinant Full Length Human DLX1 Protein, GST-tagged | +Inquiry |
DLX1-2690H | Recombinant Human DLX1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLX1-6908HCL | Recombinant Human DLX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DLX1 Products
Required fields are marked with *
My Review for All DLX1 Products
Required fields are marked with *
0
Inquiry Basket