Recombinant Full Length Human DLEU1 Protein, GST-tagged

• Cat.No.: DLEU1-3976HF
• Product Overview: Human DLEU1 full-length ORF ( AAH20692, 1 a.a. - 78 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DLEU1 (Deleted In Lymphocytic Leukemia 1 (Non-Protein Coding)) is an RNA Gene, and is affiliated with the non-coding RNA class.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 34.32 kDa
• Protein length: 78 amino acids
• AA Sequence: MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEIDDSIFY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DLEU1 deleted in lymphocytic leukemia 1 (non-protein coding) [Homo sapiens]
• Official Symbol: DLEU1
• Synonyms: deleted in lymphocytic leukemia 1 (non-protein coding); DLEU2; LEU1; LEU2; XTP6; MGC22430; NCRNA00021; Deleted in lymphocytic leukemia 1; deleted in lymphocytic leukemia, 1; HBV X-transactivated gene 6 protein; BCMS; HBV XAg-transactivated protein 6; DLB1; B-cell neoplasia-associated gene with multiple splicing; leukemia-associated protein 2; long intergenic non-protein coding RNA 21; FLJ92453; MGC22430
• Gene ID: 10301
• MIM: 605765
• UniProt ID: O43261