Recombinant Full Length Human DIRAS2 Protein, GST-tagged

• Cat.No.: DIRAS2-2571HF
• Product Overview: Human DIRAS2 full-length ORF ( NP_060064.2, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DIRAS2 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM, Apr 2004]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 48.9 kDa
• Protein length: 199 amino acids
• AA Sequence: MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DIRAS2 DIRAS family, GTP-binding RAS-like 2 [ Homo sapiens ]
• Official Symbol: DIRAS2
• Synonyms: DIRAS2; DIRAS family, GTP-binding RAS-like 2; GTP-binding protein Di-Ras2; Di Ras2; DKFZp761C07121; distinct subgroup of the Ras family member 2; Di-Ras2
• Gene ID: 54769
• mRNA Refseq: NM_017594
• Protein Refseq: NP_060064
• MIM: 607863
• UniProt ID: Q96HU8