Recombinant Full Length Human DGKA Protein, C-Flag-tagged
Cat.No. : | DGKA-627HFL |
Product Overview : | Recombinant Full Length Human DGKA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Several transcript variants encoding different isoforms have been identified for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 82.5 kDa |
AA Sequence : | MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESG RCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLE MSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFE FATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALG ATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE PWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Full Length : | Full L. |
Gene Name | DGKA diacylglycerol kinase alpha [ Homo sapiens (human) ] |
Official Symbol | DGKA |
Synonyms | DAGK; DAGK1; DGK-alpha |
Gene ID | 1606 |
mRNA Refseq | NM_201444.3 |
Protein Refseq | NP_958852.1 |
MIM | 125855 |
UniProt ID | P23743 |
◆ Recombinant Proteins | ||
DGKA-2349M | Recombinant Mouse DGKA Protein, His (Fc)-Avi-tagged | +Inquiry |
DGKA-358H | Recombinant Human DGKA Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
DGKA-627HFL | Recombinant Full Length Human DGKA Protein, C-Flag-tagged | +Inquiry |
DGKA-1854R | Recombinant Rat DGKA Protein | +Inquiry |
RFL4857BF | Recombinant Full Length Bacillus Subtilis Undecaprenol Kinase(Dgka) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGKA-6960HCL | Recombinant Human DGKA 293 Cell Lysate | +Inquiry |
DGKA-6961HCL | Recombinant Human DGKA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DGKA Products
Required fields are marked with *
My Review for All DGKA Products
Required fields are marked with *
0
Inquiry Basket