Recombinant Human DENR, His-tagged

• Cat.No.: DENR-28066TH
• Product Overview: Recombinant full length Human Density Regulated Protein with an N terminal His tag; 218 amino acids with the tag; predicted MWt: 24.3 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 198 amino acids
• Description: This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants.
• Conjugation: HIS
• Molecular Weight: 24.300kDa inclusive of tags
• Tissue specificity: Highly expressed in heart and skeletal muscle and moderately expressed in the brain, placenta, liver and pancreas. Weakly expressed in the lung and kidney.
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:20% Glycerol, 0.04% DTT, 0.88% Sodium chlorideNote: Contains 89% Tris-HCl buffer.
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
• Sequence Similarities: Belongs to the DENR family.Contains 1 SUI1 domain.

Gene Information

• Gene Name: DENR density-regulated protein [ Homo sapiens ]
• Official Symbol: DENR
• Synonyms: DENR; density-regulated protein; DRP; DRP1; SMAP 3
• Gene ID: 8562
• mRNA Refseq: NM_003677
• Protein Refseq: NP_003668
• MIM: 604550
• Uniprot ID: O43583
• Chromosome Location: 12q24.31
• Function: molecular_function; protein binding; translation initiation factor activity