Recombinant Full Length Human DEFB112 Protein, GST-tagged

• Cat.No.: DEFB112-3901HF
• Product Overview: Human DEFB112 full-length ORF (AAI48765.1, 1 a.a. - 113 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 113 amino acids
• Description: Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. [provided by RefSeq, Oct 2014]
• Molecular Mass: 39.38 kDa
• AA Sequence: MKLLTTICRLKLEKMYSKTNTSSTIFEKARHGTEKISTARSEGHHITFSRWKSCTAIGGRCKNQCDDSEFRISYCARPTTHCCVTECDPTDPNNWIPKDSVGTQEWYPKDSRH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEFB112 defensin beta 112 [ Homo sapiens (human) ]
• Official Symbol: DEFB112
• Synonyms: DEFB112; defensin beta 112; DEFB-12; beta-defensin 112; beta-defensin 12; defensin, beta 12
• Gene ID: 245915
• mRNA Refseq: NM_001037498
• Protein Refseq: NP_001032587
• UniProt ID: Q30KQ8