Recombinant Full Length Human DDX31 Protein, GST-tagged

Cat.No. : DDX31-2586HF
Product Overview : Human DDX31 full-length ORF ( NP_619526.1, 1 a.a. - 585 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 585 amino acids
Description : DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2016]
Molecular Mass : 90.75 kDa
AA Sequence : MAPDLASQRHSESFPSVNSRPNVILPGREGRREGLPPGGGTRGSLVPTRPVPPSPAPLGTSPYSWSRSGPGRGGGAGSSRVPRGVPGPAVCAPGSLLHHASPTQTMAAADGSLFDNPRTFSRRPPAQASRQAKATKRKYQASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTSDRNQEERQCIKTSSLFKNNPDIPELHRPVVKQVQEKVFTSAAFHELGLHPHLISTINTVLKMSSMTSVQKQSIPVLLEGRDALVRSQTGSGKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGVLMGGEKRKSEKARLRKGINILISTPGRLVDHIKSTKNIHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADISLHDPVSISVLDKSHDQLNPKDKAVQEVCPPPAGDKLDSFAIPESLKQHVTVVPSKLRLVCLAAFILQKCKFEEDQKMVVFFSSCELVEFHYSLFLQTLLSSSGAPASGQLPSASMRLKFLRLHGGMEQEERTAVFQEFSHSRRGVLLCT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DDX31 DEAD (Asp-Glu-Ala-Asp) box polypeptide 31 [ Homo sapiens ]
Official Symbol DDX31
Synonyms DDX31; DEAD (Asp-Glu-Ala-Asp) box polypeptide 31; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 31; probable ATP-dependent RNA helicase DDX31; FLJ13633; FLJ14578; FLJ23349; PPP1R25; protein phosphatase 1; regulatory subunit 25; helicain; G2 helicase; DEAD box protein 31; DEAD/DEXH helicase DDX31; protein phosphatase 1, regulatory subunit 25; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 31;
Gene ID 64794
mRNA Refseq NM_022779
Protein Refseq NP_073616
MIM 616533
UniProt ID Q9H8H2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DDX31 Products

Required fields are marked with *

My Review for All DDX31 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon