Recombinant Full Length Human DDI2 Protein, GST-tagged

• Cat.No.: DDI2-2449HF
• Product Overview: Human DDI2 full-length ORF ( AAH06011.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DDI2 (DNA Damage Inducible 1 Homolog 2) is a Protein Coding gene. GO annotations related to this gene include aspartic-type endopeptidase activity. An important paralog of this gene is DDI1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 50.1 kDa
• Protein length: 211 amino acids
• AA Sequence: MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQKENADPRPPVQFPNLPRIDFSSIAVPGTSSPRQRQPPGTQQSHSSPGEITSSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDIR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DDI2 DNA-damage inducible 1 homolog 2 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: DDI2
• Synonyms: DDI2; DNA-damage inducible 1 homolog 2 (S. cerevisiae); DDI1, DNA damage inducible 1, homolog 2 (S. cerevisiae); protein DDI1 homolog 2; MGC14844; DNA-damage inducible protein 2 (DDI2); DDI1, DNA-damage inducible 1, homolog 2; RP4-680D5.5
• Gene ID: 84301
• mRNA Refseq: NM_032341
• Protein Refseq: NP_115717
• UniProt ID: Q5TDH0