Recombinant Full Length Human DDI1 Protein, C-Flag-tagged
Cat.No. : | DDI1-955HFL |
Product Overview : | Recombinant Full Length Human DDI1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable aspartic-type endopeptidase activity. Involved in several processes, including cellular response to hydroxyurea; proteasomal protein catabolic process; and regulation of DNA stability. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 43.9 kDa |
AA Sequence : | MLITVYCVRRDLSEVTFSLQVSPDFELRNFKVLCEAESRVPVEEIQIIHMERLLIEDHCSLGSYGLKDGD IVVLLQKDNVGPRAPGRAPNQPRVDFSGIAVPGTSSSRPQHPGQQQQRTPAAQRSQGLASGEKVAGLQGL GSPALIRSMLLSNPHDLSLLKERNPPLAEALLSGSLETFSQVLMEQQREKALREQERLRLYTADPLDREA QAKIEEEIRQQNIEENMNIAIEEAPESFGQVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMR LVDRRWAGVAKGVGTQRIIGRVHLAQIQIEGDFLQCSFSILEDQPMDMLLGLDMLRRHQCSIDLKKNVLV IGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | DDI1 DNA damage inducible 1 homolog 1 [ Homo sapiens (human) ] |
Official Symbol | DDI1 |
Synonyms | FLJ36017 |
Gene ID | 414301 |
mRNA Refseq | NM_001001711.3 |
Protein Refseq | NP_001001711.1 |
UniProt ID | Q8WTU0 |
◆ Recombinant Proteins | ||
DDI1-1323H | Recombinant Human DDI1 Protein, His-tagged | +Inquiry |
DDI1-1030R | Recombinant Rhesus Macaque DDI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDI1-1205R | Recombinant Rhesus monkey DDI1 Protein, His-tagged | +Inquiry |
DDI1-199C | Recombinant Cynomolgus Monkey DDI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDI1-2440H | Recombinant Human DDI1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDI1-452HCL | Recombinant Human DDI1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDI1 Products
Required fields are marked with *
My Review for All DDI1 Products
Required fields are marked with *
0
Inquiry Basket