Recombinant Full Length Human DCUN1D5 Protein, GST-tagged

• Cat.No.: DCUN1D5-2417HF
• Product Overview: Human DCUN1D5 full-length ORF ( NP_115675.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DCUN1D5 (Defective In Cullin Neddylation 1 Domain Containing 5) is a Protein Coding gene. An important paralog of this gene is DCUN1D4.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 53.9 kDa
• Protein length: 237 amino acids
• AA Sequence: MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEWQKVRQTS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCUN1D5 DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: DCUN1D5
• Synonyms: DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae); Defective in cullin neddylation protein 1-like protein 5; FLJ32431; MGC2714; DCN1-like protein 5; DCUN1D5
• Gene ID: 84259
• mRNA Refseq: NM_032299.3
• Protein Refseq: NP_115675.1
• MIM: 616522
• UniProt ID: Q9BTE7