Recombinant Full Length Human DCUN1D4 Protein, GST-tagged

Cat.No. : DCUN1D4-2415HF
Product Overview : Human DCUN1D4 full-length ORF ( ENSP00000263922, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 197 amino acids
Description : DCUN1D4 (Defective In Cullin Neddylation 1 Domain Containing 4) is a Protein Coding gene. An important paralog of this gene is DCUN1D5.
Molecular Mass : 49.8 kDa
AA Sequence : MPPRKKRRPASGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAGTDDVVGPEGMEKFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFARQSKYKVINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEWYKDKQMS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DCUN1D4 DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) [ Homo sapiens ]
Official Symbol DCUN1D4
Synonyms DCUN1D4; DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae); DCN1-like protein 4; KIAA0276; DCUN1 domain-containing protein 4; defective in cullin neddylation protein 1-like protein 4; FLJ42355;
Gene ID 23142
mRNA Refseq NM_001040402
Protein Refseq NP_001035492
MIM 612977
UniProt ID Q92564

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DCUN1D4 Products

Required fields are marked with *

My Review for All DCUN1D4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon