Recombinant Full Length Human DCTPP1 Protein, C-Flag-tagged

• Cat.No.: DCTPP1-2046HFL
• Product Overview: Recombinant Full Length Human DCTPP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The protein encoded by this gene is dCTP pyrophosphatase, which converts dCTP to dCMP and inorganic pyrophosphate. The encoded protein also displays weak activity against dTTP and dATP, but none against dGTP. This protein may be responsible for eliminating excess dCTP after DNA synthesis and may prevent overmethylation of CpG islands. Three transcript variants, one protein-coding and the other two non-protein coding, have been found for this gene.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 18.5 kDa
• AA Sequence: MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAEL FQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRK YTELPHGAISEDQAVGPADIPCDSTGQTST myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Stem cell - Pluripotency
• Full Length: Full L.

Gene Information

• Gene Name: DCTPP1 dCTP pyrophosphatase 1 [ Homo sapiens (human) ]
• Official Symbol: DCTPP1
• Synonyms: CDA03; RS21C6; XTP3TPA
• Gene ID: 79077
• mRNA Refseq: NM_024096.2
• Protein Refseq: NP_077001.1
• MIM: 615840
• UniProt ID: Q9H773