Recombinant Full Length Human DCP1A Protein, C-Flag-tagged
Cat.No. : | DCP1A-2028HFL |
Product Overview : | Recombinant Full Length Human DCP1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. Alternative splicing of this gene results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 63.1 kDa |
AA Sequence : | MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIV NRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDK QSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSA PSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAA HHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR QRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVAS FSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLV TATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSS FLSTLHEVYLQVLTKNKDNHNL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Protein Pathways : | RNA degradation |
Full Length : | Full L. |
Gene Name | DCP1A decapping mRNA 1A [ Homo sapiens (human) ] |
Official Symbol | DCP1A |
Synonyms | SMIF; SMAD4IP1; HSA275986; Nbla00360 |
Gene ID | 55802 |
mRNA Refseq | NM_018403.7 |
Protein Refseq | NP_060873.4 |
MIM | 607010 |
UniProt ID | Q9NPI6 |
◆ Recombinant Proteins | ||
DCP1A-2888HF | Recombinant Full Length Human DCP1A Protein, GST-tagged | +Inquiry |
DCP1A-291H | Recombinant Human DCP1A Protein, His-tagged | +Inquiry |
Dcp1a-2476M | Recombinant Mouse Dcp1a Protein, Myc/DDK-tagged | +Inquiry |
DCP1A-726H | Recombinant Human DCP1A Protein, His (Fc)-Avi-tagged | +Inquiry |
DCP1A-2236M | Recombinant Mouse DCP1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCP1A-7048HCL | Recombinant Human DCP1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCP1A Products
Required fields are marked with *
My Review for All DCP1A Products
Required fields are marked with *
0
Inquiry Basket