Recombinant Full Length Human DBX1 Protein, GST-tagged

Cat.No. : DBX1-2713HF
Product Overview : Human DBX1 full-length ORF ( AAI56155.1, 1 a.a. - 382 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : DBX1 (Developing Brain Homeobox 1) is a Protein Coding gene. Diseases associated with DBX1 include Central Hypoventilation Syndrome, Congenital. GO annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is DBX2.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 42.1 kDa
Protein length : 382 amino acids
AA Sequence : MMFPGLLAPPAGYPSLLRPTPTLTLPQSLQSAFSGHSSFLVEDLIRISRPPAYLPRSVPTASMSPPRQGAPTALTDTGASDLGSPGPGSRRGGSPPTAFSPASETTFLKFGVNAILSSGPRTETSPALLQSVPPKTFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDSQDTARRTEPAPDSTPRPRASPGAPDLTSASPFFSPAGTFQVKIWFQNRRMKWRNSKERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDPQHLRDPRLPGPLPPSPAHSSSPGKPSDFSDSEEEEEGEEQEEITVS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DBX1 developing brain homeobox 1 [ Homo sapiens ]
Official Symbol DBX1
Synonyms DBX1; developing brain homeobox 1; homeobox protein DBX1; developing brain homeobox protein 1;
Gene ID 120237
mRNA Refseq NM_001029865
Protein Refseq NP_001025036
MIM 619830
UniProt ID A6NMT0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DBX1 Products

Required fields are marked with *

My Review for All DBX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon