Recombinant Full Length Human DBX1 Protein, GST-tagged

• Cat.No.: DBX1-2713HF
• Product Overview: Human DBX1 full-length ORF ( AAI56155.1, 1 a.a. - 382 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DBX1 (Developing Brain Homeobox 1) is a Protein Coding gene. Diseases associated with DBX1 include Central Hypoventilation Syndrome, Congenital. GO annotations related to this gene include sequence-specific DNA binding. An important paralog of this gene is DBX2.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 42.1 kDa
• Protein length: 382 amino acids
• AA Sequence: MMFPGLLAPPAGYPSLLRPTPTLTLPQSLQSAFSGHSSFLVEDLIRISRPPAYLPRSVPTASMSPPRQGAPTALTDTGASDLGSPGPGSRRGGSPPTAFSPASETTFLKFGVNAILSSGPRTETSPALLQSVPPKTFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDSQDTARRTEPAPDSTPRPRASPGAPDLTSASPFFSPAGTFQVKIWFQNRRMKWRNSKERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEEGPGSPSHRLAYHASSDPQHLRDPRLPGPLPPSPAHSSSPGKPSDFSDSEEEEEGEEQEEITVS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DBX1 developing brain homeobox 1 [ Homo sapiens ]
• Official Symbol: DBX1
• Synonyms: DBX1; developing brain homeobox 1; homeobox protein DBX1; developing brain homeobox protein 1
• Gene ID: 120237
• mRNA Refseq: NM_001029865
• Protein Refseq: NP_001025036
• MIM: 619830
• UniProt ID: A6NMT0