Recombinant Full Length Human DBR1 Protein, C-Flag-tagged
Cat.No. : | DBR1-428HFL |
Product Overview : | Recombinant Full Length Human DBR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is an RNA lariat debranching enzyme that hydrolyzes 2'-5' prime branched phosphodiester bonds. The encoded protein specifically targets the bonds at the branch point of excised lariat intron RNA, converting them to linear molecules that are then degraded. This protein may also be involved in retroviral replication. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 61.4 kDa |
AA Sequence : | MRVAVAGCCHGELDKIYETLALAERRGPGPVDLLLCCGDFQAVRNEADLRCMAVPPKYRHMQTFYRYYSG EKKAPVLTLFIGGNHEASNHLQELPYGGWVAPNIYYLGLAGVVKYRGVRIGGISGIFKSHDYRKGHFECP PYNSSTIRSIYHVRNIEVYKLKQLKQPIDIFLSHDWPRSIYHYGNKKQLLKTKSFFRQEVENNTLGSPAA SELLEHLKPTYWFSAHLHVKFAALMQHQAKDKGQTARATKFLALDKCLPHRDFLQILEIEHDPSAPDYLE YDIEWLTILRATDDLINVTGRLWNMPENNGLHARWDYSATEEGMKEVLEKLNHDLKVPCNFSVTAACYDP SKPQTQMQLIHRINPQTTEFCAQLGIIDINVRLQKSKEEHHVCGEYEEQDDVESNDSGEDQSEYNTDTSA LSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDRE GKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDDDDDDAATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | DBR1 debranching RNA lariats 1 [ Homo sapiens (human) ] |
Official Symbol | DBR1 |
Synonyms | debranching enzyme homolog 1; debranching enzyme homolog 1 (S. cerevisiae); RNA lariat debranching enzyme |
Gene ID | 51163 |
mRNA Refseq | NM_016216.4 |
Protein Refseq | NP_057300.2 |
MIM | 51163 |
UniProt ID | Q9UK59 |
◆ Recombinant Proteins | ||
DBR1-3208C | Recombinant Chicken DBR1 | +Inquiry |
DBR1-2608HF | Recombinant Full Length Human DBR1 Protein, GST-tagged | +Inquiry |
DBR1-11847H | Recombinant Human DBR1, His-tagged | +Inquiry |
DBR1-2374H | Recombinant Human DBR1 Protein, GST-tagged | +Inquiry |
DBR1-1006R | Recombinant Rhesus Macaque DBR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DBR1-443HCL | Recombinant Human DBR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DBR1 Products
Required fields are marked with *
My Review for All DBR1 Products
Required fields are marked with *
0
Inquiry Basket