Recombinant Full Length Human DAP Protein, GST-tagged

• Cat.No.: DAP-2381HF
• Product Overview: Human DAP full-length ORF ( AAH02726, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 102 amino acids
• Description: This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014]
• Molecular Mass: 36.96 kDa
• AA Sequence: MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DAP death-associated protein [ Homo sapiens ]
• Official Symbol: DAP
• Synonyms: DAP; death-associated protein; death-associated protein 1; DAP-1; MGC99796
• Gene ID: 1611
• mRNA Refseq: NM_004394
• Protein Refseq: NP_004385
• MIM: 600954
• UniProt ID: P51397