Recombinant Full Length Human DAD1 Protein

• Cat.No.: DAD1-120HF
• Product Overview: Recombinant full length Human DAD1 with N terminal proprietary tag, 38.17 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 113 amino acids
• Description: DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line.The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis.DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes.
• Form: Liquid
• Molecular Mass: 38.170kDa inclusive of tags
• AA Sequence: MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGAL QFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQ NKADFQGISPERAFADFLFASTILHLVVMNFVG
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: DAD1 defender against cell death 1 [ Homo sapiens ]
• Official Symbol: DAD1
• Synonyms: DAD1; defender against cell death 1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; oligosaccharyltransferase 2 homolog (S. cerevisiae); OST2
• Gene ID: 1603
• mRNA Refseq: NM_001344
• Protein Refseq: NP_001335
• MIM: 600243
• UniProt ID: P61803