Recombinant Full Length Human Cytomegalovirus Transmembrane Protein Hwlf3(Us20) Protein, His-Tagged
Cat.No. : | RFL11961HF |
Product Overview : | Recombinant Full Length Human cytomegalovirus Transmembrane protein HWLF3(US20) Protein (P09724) (1-342aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HHV5 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-342) |
Form : | Lyophilized powder |
AA Sequence : | MRVISRARSACTWTSCTSLSPCSTSCPPSPAAPTLLRRRSLPQQRRRPSSSPNRRVRGVT TSPCPTRSLVYKRRVGAPQRLCAETVATMQAQEANALLLSRMEALEWFKKFTVWLRVYAI FIFQLAFSFGLGSVFWLGFPQNRNFCVENYSFFLTVLVPIVCMFITYTLGNEHPSNATVL FIYLLANSLTAAIFQMCSESRVLVGSYVMTLALFISFTGLAFLGGRDRRRWKCISCVYVV MLLSFLTLALLSDADWLQKIVVTLCAFSISFFLGILAYDSLMVIFFCPPNQCIRHAVCLY LDSMAIFLTLLLMLSGPRWISLSDGAPLDNGTLTAASTTGKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | US20 |
Synonyms | US20; Transmembrane protein HWLF3 |
UniProt ID | P09724 |
◆ Native Proteins | ||
IgE-18H | Native Human Immunoglobulin E, lambda | +Inquiry |
Lectin-1723C | Native Canavalia ensiformis Lectin, FITC conjugated | +Inquiry |
HBsAg-01 | Native Hepatitis B Surface Ag protein | +Inquiry |
lalp-237H | Active Native Human Inter Alpha Inhibitor Proteins (IaIp) | +Inquiry |
SUOX-248G | Active Native Chicken Sulfite Oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC29A4-602HCL | Recombinant Human SLC29A4 lysate | +Inquiry |
DMRT1-6898HCL | Recombinant Human DMRT1 293 Cell Lysate | +Inquiry |
JDP2-5104HCL | Recombinant Human JDP2 293 Cell Lysate | +Inquiry |
TIMM21-217HCL | Recombinant Human TIMM21 cell lysate | +Inquiry |
PPP2R5D-2914HCL | Recombinant Human PPP2R5D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All US20 Products
Required fields are marked with *
My Review for All US20 Products
Required fields are marked with *
0
Inquiry Basket