Recombinant Full Length Human Cytomegalovirus Immediate Early Glycoprotein(Ul37) Protein, His-Tagged
Cat.No. : | RFL2094HF |
Product Overview : | Recombinant Full Length Human cytomegalovirus Immediate early glycoprotein(UL37) Protein (P16778) (23-487aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HHV5 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-487) |
Form : | Lyophilized powder |
AA Sequence : | RWIQRKRLEDPLPPWLRKKKACALTRRSRHRLRRQHGVIDGENSETERSVDLVAALLAEA GEESVTEDTEREDTEEEREDEEEENEARTPEVNPIDAEGLSGLAREACEALKKALRRHRF LWQRRQRARMLQHNGPQQSHHAAVFCRVHGLRGFQVSVWLLLTLLWSTGHGVSVRCTYHG TDVNRTSNTTSMNCHLNCTRNHTQIYNGPCLGTEARLPLNVTFNQSRRKWHSVMLKFGFQ YHLEGWFPLRVLNESREINVTEVHGEVACFRNDTNVTVGQLTLNFTGHSYVLRAIAHTSP FESYVRWEETNVTDNATSSENTTTVMSTLTKYAESDYIFLQDMCPRFLKRTVKLTRNKTK HNVTVTGNNMTTLPVWTPECKGWTYWTTLSVMWRNRRSALLRAKSRALGHWALLSICTVA AGSIALLSLFCILLIGLRRDLLEDFRYICRDEGSSSTKNDVHRIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UL37 |
Synonyms | UL37; UL37 immediate early glycoprotein |
UniProt ID | P16778 |
◆ Recombinant Proteins | ||
FAM3C-5591M | Recombinant Mouse FAM3C Protein | +Inquiry |
ACTR8-151H | Recombinant Human ACTR8 Protein, His-tagged | +Inquiry |
FKBP9-4199H | Recombinant Human FKBP9 Protein, GST-tagged | +Inquiry |
SLC7A13-5233R | Recombinant Rat SLC7A13 Protein, His (Fc)-Avi-tagged | +Inquiry |
GZMB-3093H | Recombinant Human GZMB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CAT-5276H | Native Human, Catalase | +Inquiry |
HB-43R | Native Rat Hemoglobin (HB) Protein | +Inquiry |
LDH3-22H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
S100A11-3111H | Native Human S100A11 protein(Met1-Thr105) | +Inquiry |
Luciferase-10V | Native Vibrio fischeri Luciferase | +Inquiry |
◆ Cell & Tissue Lysates | ||
RMND5A-2326HCL | Recombinant Human RMND5A 293 Cell Lysate | +Inquiry |
AKAP17A-1591HCL | Recombinant Human AKAP17A cell lysate | +Inquiry |
MET-2047MCL | Recombinant Mouse MET cell lysate | +Inquiry |
UBE2H-575HCL | Recombinant Human UBE2H 293 Cell Lysate | +Inquiry |
CCL23-7727HCL | Recombinant Human CCL23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All UL37 Products
Required fields are marked with *
My Review for All UL37 Products
Required fields are marked with *
0
Inquiry Basket