Recombinant Full Length Human CYP3A4 Protein
Cat.No. : | CYP3A4-117HF |
Product Overview : | Recombinant full length Human Cytochrome P450 3A4 protein with an N terminal proprietary tag; predicted MW: 81.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 503 amino acids |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam and erythromycin. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist; however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Form : | Liquid |
Molecular Mass : | 81.400kDa |
AA Sequence : | MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPG PTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQP VLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNL RREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQ DPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICV FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQN SKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYE LATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYA LHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPR NCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLG GLLQPEKPVVLKVESRDGTVSGA |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CYP3A4 cytochrome P450, family 3, subfamily A, polypeptide 4 [ Homo sapiens ] |
Official Symbol | CYP3A4 |
Synonyms | CYP3A4; cytochrome P450, family 3, subfamily A, polypeptide 4; CYP3A3, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4; cytochrome P450 3A4 |
Gene ID | 1576 |
mRNA Refseq | NM_001202855 |
Protein Refseq | NP_001189784 |
MIM | 124010 |
UniProt ID | P08684 |
◆ Recombinant Proteins | ||
CYP3A4-18H | Recombinant Human CYP3A4 protein, MYC/DDK-tagged | +Inquiry |
CYP3A4-549H | Active Recombinant Human CYP3A4 | +Inquiry |
CYP3A4-33H | Recombinant Human CYP3A4/NADPH reductase protein | +Inquiry |
CYP3A4-1158R | Recombinant Rhesus monkey CYP3A4 Protein, His-tagged | +Inquiry |
CYP3A4-117HF | Recombinant Full Length Human CYP3A4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP3A4-436HCL | Recombinant Human CYP3A4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP3A4 Products
Required fields are marked with *
My Review for All CYP3A4 Products
Required fields are marked with *
0
Inquiry Basket