Recombinant Full Length Human CYP2W1 Protein, C-Flag-tagged
Cat.No. : | CYP2W1-1740HFL |
Product Overview : | Recombinant Full Length Human CYP2W1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.7 kDa |
AA Sequence : | MALLLLLFLGLLGLWGLLCACAQDPSPAARWPPGPRPLPLVGNLHLLRLSQQDRSLMELSERYGPVFTVH LGRQKTVVLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGR EPVADKILQELKCLSGQLDGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLGLIDEVMVLLG SPGLQLFNVYPWLGALLQLHRPVLRKIEEVRAILRTLLEARRPHVCPGDPVCSYVDALIQQGQGDDPEGL FAEANAVACTLDMVMAGTETTSATLQWAALLMGRHPDVQGRVQEELDRVLGPGRTPRLEDQQALPYTSAV LHEVQRFITLLPHVPRCTAADTQLGGFLLPKGTPVIPLLTSVLLDETQWQTPGQFNPGHFLDANGHFVKR EAFLPFSAGRRVCVGERLARTELFLLFAGLLQRYRLLPPPGVSPASLDTTPARAFTMRPRAQALCAVPRPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, P450 |
Full Length : | Full L. |
Gene Name | CYP2W1 cytochrome P450 family 2 subfamily W member 1 [ Homo sapiens (human) ] |
Official Symbol | CYP2W1 |
Synonyms | MGC34287 |
Gene ID | 54905 |
mRNA Refseq | NM_017781.3 |
Protein Refseq | NP_060251.2 |
MIM | 615967 |
UniProt ID | Q8TAV3 |
◆ Recombinant Proteins | ||
CYP2W1-1740HFL | Recombinant Full Length Human CYP2W1 Protein, C-Flag-tagged | +Inquiry |
CYP2W1-4204M | Recombinant Mouse CYP2W1 Protein | +Inquiry |
CYP2W1-2152M | Recombinant Mouse CYP2W1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cyp2w1-2420M | Recombinant Mouse Cyp2w1 Protein, Myc/DDK-tagged | +Inquiry |
CYP2W1-2271H | Recombinant Human CYP2W1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP2W1-7107HCL | Recombinant Human CYP2W1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP2W1 Products
Required fields are marked with *
My Review for All CYP2W1 Products
Required fields are marked with *
0
Inquiry Basket