Recombinant Full Length Human CYB5R1 Protein, GST-tagged

• Cat.No.: CYB5R1-2383HF
• Product Overview: Human CYB5R1 full-length ORF ( NP_057327.2, 1 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CYB5R1 (Cytochrome B5 Reductase 1) is a Protein Coding gene. Among its related pathways are Response to elevated platelet cytosolic Ca2+ and Erythrocytes take up carbon dioxide and release oxygen. GO annotations related to this gene include oxidoreductase activity and cytochrome-b5 reductase activity, acting on NAD(P)H. An important paralog of this gene is CYB5R3.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 60.5 kDa
• Protein length: 305 amino acids
• AA Sequence: MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYB5R1 cytochrome b5 reductase 1 [ Homo sapiens ]
• Official Symbol: CYB5R1
• Synonyms: CYB5R1; cytochrome b5 reductase 1; NAD(P)H:quinone oxidoreductase type 3, polypeptide A2 , NQO3A2; NADH-cytochrome b5 reductase 1; humb5R2; NAD(P)H:quinone oxidoreductase type 3 polypeptide A2; NAD(P)H:quinone oxidoreductase type 3, polypeptide A2; B5R1; B5R.1; NQO3A2
• Gene ID: 51706
• mRNA Refseq: NM_016243
• Protein Refseq: NP_057327
• MIM: 608341
• UniProt ID: Q9UHQ9