Recombinant Full Length Human CXXC4 Protein, GST-tagged

• Cat.No.: CXXC4-2373HF
• Product Overview: Human CXXC4 full-length ORF ( NP_079488.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 198 amino acids
• Description: This gene encodes a CXXC-type zinc finger domain-containing protein that functions as an antagonist of the canonical wingless/integrated signaling pathway. The encoded protein negatively regulates wingless/integrated signaling through interaction with the post synaptic density protein/ Drosophila disc large tumor suppressor/ zonula occludens-1 protein domain of Dishevelled, a scaffolding protein required for the stabilization of the transcriptional co-activator beta-catenin. In addition, the CXXC domain of this protein has been shown to bind unmethylated CpG dinucleotides, localize to promoters and CpG islands, and interact with the catalytic domain of methylcytosine dioxygenase ten-eleven-translocation 2, an iron and alpha-ketoglutarate-dependent dioxygenase that modifies the methylation status of DNA. In humans, a mutation in this gene has been associated with development of malignant renal cell carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
• Molecular Mass: 47.4 kDa
• AA Sequence: MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CXXC4 CXXC finger protein 4 [ Homo sapiens ]
• Official Symbol: CXXC4
• Synonyms: CXXC4; CXXC finger protein 4; CXXC-type zinc finger protein 4; Dvl binding protein IDAX (inhibition of the Dvl and Axin complex); IDAX; CXXC finger 4; inhibition of the Dvl and axin complex protein; Dvl-binding protein IDAX (inhibition of the Dvl and Axin complex); MGC149872
• Gene ID: 80319
• mRNA Refseq: NM_025212
• Protein Refseq: NP_079488
• MIM: 611645
• UniProt ID: Q9H2H0