Recombinant Full Length Human Cxxc-Type Zinc Finger Protein 11(Cxxc11) Protein, His-Tagged
Cat.No. : | RFL784HF |
Product Overview : | Recombinant Full Length Human CXXC-type zinc finger protein 11(CXXC11) Protein (Q14D33) (1-572aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-572) |
Form : | Lyophilized powder |
AA Sequence : | MDRAGADMWASTFTLAMAERKPQDVWVLLPEHSLVPGCLDGGGVQYLLVGLSRLQCGHCP GTWDSAHVHVLFHLWWDRASHRGLVKMRIWGQRCRLCPAPGDCQVRPPGEQPFLSRLVLH ILQDCYGDGPGPARHPREAYEGCCEACELGVCFLQKAPDPAWSANATKGNFPATAWGGTG TVSRGKPLSTPGDDLGKGGVVIAIPFSLVGTSNDQVPIAEGPAPPAGASLPVTGSCEALV IGQGSIFLSGDSVAMPGGKGFPVAIGDPLFHGPGLLGSSIQTFELKGFLFKGRGSLCSPV GVAQGWGPISLNNGLVPVGKHTPTVFYCVGLSASGEGSLTFPSSLTSIFTNTLSEPTDGP VATKEASITFPFIFTDVKDAVAEVAEGNGKEGGGQGLVPVGHDALPETNAGGLPSQVKGS LALPFPADVQGKDAFTDITEGKEKEGGLVTAGHDAPLEANAEGPITVSEGCITIPFAVFD VIKRKGGGHVAYGPQGNGCFSQGYYQKRQLRSRFHKARCGCRREEDERPGRACRRPHAEP YEDFWIWVSMTVCVFWLMCMCRLNPGIYPQQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RTP5 |
Synonyms | RTP5; C2orf85; CXXC11; Z3CXXC5; Receptor-transporting protein 5; 3CxxC-type zinc finger protein 5; CXXC-type zinc finger protein 11 |
UniProt ID | Q14D33 |
◆ Native Proteins | ||
MPOC-235H | Active Native Human Myeloperoxidase Isoform C | +Inquiry |
Lecithin-10S | Native Soy Lecithin | +Inquiry |
MUC1-376H | Active Native Human MUC1 | +Inquiry |
Lectin-1834R | Active Native Ricinus Communis Agglutinin II Protein | +Inquiry |
CPB-01P | Native Porcine Carboxypeptidase B | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUMB-3634HCL | Recombinant Human NUMB 293 Cell Lysate | +Inquiry |
GBP1-1686HCL | Recombinant Human GBP1 cell lysate | +Inquiry |
SLK-1681HCL | Recombinant Human SLK 293 Cell Lysate | +Inquiry |
YME1L1-242HCL | Recombinant Human YME1L1 293 Cell Lysate | +Inquiry |
ZC3H3-746HCL | Recombinant Human ZC3H3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RTP5 Products
Required fields are marked with *
My Review for All RTP5 Products
Required fields are marked with *
0
Inquiry Basket