Recombinant Full Length Human CXCL16 Protein, GST-tagged

• Cat.No.: CXCL16-2286HF
• Product Overview: Human CXCL16 full-length ORF ( AAH17588, 49 a.a. - 273 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CXCL16 (C-X-C Motif Chemokine Ligand 16) is a Protein Coding gene. Diseases associated with CXCL16 include Xanthogranulomatous Cholecystitis. Among its related pathways arePeptide ligand-binding receptors and Chemokine Superfamily Pathway: Human/Mouse Ligand-Receptor Interactions. GO annotations related to this gene include chemokine activity andlow-density lipoprotein receptor activity.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 50.49 kDa
• Protein length: 49-273 amino acids
• AA Sequence: NEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CXCL16 chemokine (C-X-C motif) ligand 16 [ Homo sapiens ]
• Official Symbol: CXCL16
• Synonyms: CXCL16; chemokine (C-X-C motif) ligand 16; C-X-C motif chemokine 16; CXC chemokine ligand 16; CXCLG16; SR PSOX; SRPSOX; small-inducible cytokine B16; transmembrane chemokine CXCL16; scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; SR-PSOX
• Gene ID: 58191
• mRNA Refseq: NM_001100812
• Protein Refseq: NP_001094282
• MIM: 605398
• UniProt ID: Q9H2A7