Recombinant Full Length Human CTXN1 Protein, GST-tagged
Cat.No. : | CTXN1-2369HF |
Product Overview : | Human CTXN1 full-length ORF (1 a.a. - 82 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 82 amino acids |
Description : | CTXN1 (Cortexin 1) is a Protein Coding gene. An important paralog of this gene is CTXN3. |
Molecular Mass : | 35.42 kDa |
AA Sequence : | MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASSWTDHKEALERGQFDYALV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTXN1 cortexin 1 [ Homo sapiens ] |
Official Symbol | CTXN1 |
Synonyms | CTXN |
Gene ID | 404217 |
mRNA Refseq | NM_206833.3 |
Protein Refseq | NP_996664.1 |
MIM | 600135 |
UniProt ID | P60606 |
◆ Recombinant Proteins | ||
CTXN1-918R | Recombinant Rhesus Macaque CTXN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTXN1-1334R | Recombinant Rat CTXN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL21388HF | Recombinant Full Length Human Cortexin-1(Ctxn1) Protein, His-Tagged | +Inquiry |
CTXN1-2369HF | Recombinant Full Length Human CTXN1 Protein, GST-tagged | +Inquiry |
RFL6019RF | Recombinant Full Length Rat Cortexin-1(Ctxn1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTXN1 Products
Required fields are marked with *
My Review for All CTXN1 Products
Required fields are marked with *
0
Inquiry Basket