Recombinant Full Length Human CTXN1 Protein, GST-tagged

Cat.No. : CTXN1-2369HF
Product Overview : Human CTXN1 full-length ORF (1 a.a. - 82 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CTXN1 (Cortexin 1) is a Protein Coding gene. An important paralog of this gene is CTXN3.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 35.42 kDa
Protein length : 82 amino acids
AA Sequence : MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASSWTDHKEALERGQFDYALV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CTXN1 cortexin 1 [ Homo sapiens ]
Official Symbol CTXN1
Synonyms CTXN
Gene ID 404217
mRNA Refseq NM_206833.3
Protein Refseq NP_996664.1
MIM 600135
UniProt ID P60606

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CTXN1 Products

Required fields are marked with *

My Review for All CTXN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon