Recombinant Full Length Human CTSK Protein, GST-tagged

• Cat.No.: CTSK-2354HF
• Product Overview: Human CTSK full-length ORF ( AAH16058, 15 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 329 amino acids
• Description: The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. [provided by RefSeq, Apr 2013]
• Molecular Mass: 60.28 kDa
• AA Sequence: ALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CTSK cathepsin K [ Homo sapiens ]
• Official Symbol: CTSK
• Synonyms: CTSK; cathepsin K; cathepsin K (pycnodysostosis) , CTSO, CTSO2, PYCD; PKND; cathepsin O; cathepsin X; cathepsin O1; cathepsin O2; CTSO; PYCD; CTS02; CTSO1; CTSO2; MGC23107
• Gene ID: 1513
• mRNA Refseq: NM_000396
• Protein Refseq: NP_000387
• MIM: 601105
• UniProt ID: P43235