Recombinant Full Length Human CTPS1 Protein, C-Flag-tagged
Cat.No. : | CTPS1-478HFL |
Product Overview : | Recombinant Full Length Human CTPS1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an enzyme responsible for the catalytic conversion of UTP (uridine triphosphate) to CTP (cytidine triphospate). This reaction is an important step in the biosynthesis of phospholipids and nucleic acids. Activity of this proten is important in the immune system, and loss of function of this gene has been associated with immunodeficiency. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 66.5 kDa |
AA Sequence : | MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLD LGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEP QVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLS PDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRK MLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEE PVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDAN STEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKK CLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCR LSPRDTYSDRIGSSSPDSEITELKFPSINHDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Metabolic pathways, Pyrimidine metabolism |
Full Length : | Full L. |
Gene Name | CTPS1 CTP synthase 1 [ Homo sapiens (human) ] |
Official Symbol | CTPS1 |
Synonyms | CTPS; GATD5; IMD24; GATD5A |
Gene ID | 1503 |
mRNA Refseq | NM_001905.4 |
Protein Refseq | NP_001896.2 |
MIM | 123860 |
UniProt ID | P17812 |
◆ Recombinant Proteins | ||
CTPS1-188H | Recombinant Human CTPS1 | +Inquiry |
CTPS1-3379H | Recombinant Human CTPS1 Protein, MYC/DDK-tagged | +Inquiry |
CTPS1-1753H | Recombinant Human CTPS1 Protein (1-591 aa), His-tagged | +Inquiry |
CTPS1-478HFL | Recombinant Full Length Human CTPS1 Protein, C-Flag-tagged | +Inquiry |
CTPS1-1137H | Recombinant Human CTPS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTPS1 Products
Required fields are marked with *
My Review for All CTPS1 Products
Required fields are marked with *
0
Inquiry Basket