Recombinant Full Length Human CT55 Protein, GST-tagged

• Cat.No.: CT55-2351HF
• Product Overview: Human CXorf48 full-length ORF ( NP_001026875.1, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 264 amino acids
• Description: CT55 (Cancer/Testis Antigen 55) is a Protein Coding gene.
• Molecular Mass: 55.5 kDa
• AA Sequence: MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFSSDVVTGNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTSINEDNIYISNSIYFSIAIVSEDFVPYKGDLLEVEYSTEPGISNIKATSVKPIRCIHTEEVCITSVHGRNGVIDYTIFFTLDSVKLPDGYVPQVDDIVNVVMVESIQFCFIWRAISITPVHKSSSGFQDDGGLGRPKRERRSQSI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CT55 cancer/testis antigen 55 [ Homo sapiens (human) ]
• Official Symbol: CT55
• Synonyms: CXORF48; chromosome X open reading frame 48; uncharacterized protein CXorf48; cancer/testis antigen 55; CT55; FLJ20527; tumor antigen BJ-HCC-20; BRCA2-interacting protein; BJHCC20A; RP13-565O16.1
• Gene ID: 54967
• mRNA Refseq: NM_001031705
• Protein Refseq: NP_001026875
• UniProt ID: Q8WUE5