Recombinant Full Length Thermotoga Maritima Methyl-Accepting Chemotaxis Protein 2(Mcp2) Protein, His-Tagged
Cat.No. : | RFL6628TF |
Product Overview : | Recombinant Full Length Thermotoga maritima Methyl-accepting chemotaxis protein 2(mcp2) Protein (Q9X0M7) (1-530aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermotoga maritima |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-530) |
Form : | Lyophilized powder |
AA Sequence : | MSLKGKTLLVSTITLAAVVLVALLGGSVFLKAGQNVRKAFEEYELAVEALDKLGELETKV ALFVNNAAKIEEVSSLFNELKKVADKIPSLKEHMDALERNISEIISGKTEVVSRIQSSVD QVKEDIMANLDRTRENLDKEISYSSELIRNVLFIVLPIVAVASGVFLFVMISRSLRLLKP VMEASRSLRNNDLTINIQEAKGKDEISTLLNEFKASIEYLRNNLKDVQTETFSVAESIEE ISKANEEITNQLLGISKEMDNISTRIESISASVQETTAGSEEISSATKNIADSAQQAASF ADQSTQLAKEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAEQT NLLALNAAIEAARAGEAGRGFAVVADEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVS SEITARVEEGTKLADEADEKLNSIVGAVERINEMLQNIAAAIEEQTAAVDEITTAMTENA KNAEEITNSVKEVNARLQEISASTEEVTSRVQTIRENVQMLKEIVARYKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mcp2 |
Synonyms | mcp2; TM_1143; Methyl-accepting chemotaxis protein 2 |
UniProt ID | Q9X0M7 |
◆ Recombinant Proteins | ||
CACNG3-432R | Recombinant Rhesus Macaque CACNG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM200A-251C | Recombinant Cynomolgus Monkey FAM200A Protein, His (Fc)-Avi-tagged | +Inquiry |
TUBB4-806C | Recombinant Cynomolgus Monkey TUBB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
BTC-1378H | Recombinant Human BTC Protein (Asp32-Tyr111), His tagged | +Inquiry |
NDUFS7-10547M | Recombinant Mouse NDUFS7 Protein | +Inquiry |
◆ Native Proteins | ||
MLC-240H | Native Human Myosin Light Chain | +Inquiry |
ALB-198B | Native Bovine ALB protein, methylated | +Inquiry |
Lectin-1790G | Active Native Griffonia Simplicifolia Lectin II Protein | +Inquiry |
IgG-009H | Native Hamster Whole Molecule IgG, Biotin Conjugate | +Inquiry |
CA2-34R | Native Rabbit Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2668HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
IGFBP5-001CCL | Recombinant Canine IGFBP5 cell lysate | +Inquiry |
PLEKHG2-1375HCL | Recombinant Human PLEKHG2 cell lysate | +Inquiry |
PAGE2-467HCL | Recombinant Human PAGE2 lysate | +Inquiry |
STX19-1378HCL | Recombinant Human STX19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mcp2 Products
Required fields are marked with *
My Review for All mcp2 Products
Required fields are marked with *
0
Inquiry Basket