Recombinant Full Length Human CT45A3 Protein, GST-tagged

• Cat.No.: CT45A3-2254HF
• Product Overview: Human CT45-4 full-length ORF ( AAI53114.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 189 amino acids
• Description: CT45A3 (Cancer/Testis Antigen Family 45 Member A3) is a Protein Coding gene. An important paralog of this gene is CT45A6.
• Molecular Mass: 47.19 kDa
• AA Sequence: MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQQEINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CT45A3 cancer/testis antigen family 45, member A3 [ Homo sapiens ]
• Official Symbol: CT45A3
• Synonyms: CT45A3; cancer/testis antigen family 45, member A3; cancer/testis antigen family 45 member A3; cancer/testis antigen CT45 3; CT45 3; CT45.3; Cancer/testis antigen 45-3; Cancer/testis antigen 45A3; Cancer/testis antigen family 45 member A3; CT453_HUMAN; CT45A3; cancer/testis antigen 45-3; cancer/testis antigen 45A3; cancer/testis antigen CT45-3; CT45-3; RP13-36C9.1; RP13-36C9.3
• Gene ID: 441519
• mRNA Refseq: NM_001017435
• Protein Refseq: NP_001017435
• MIM: 300794
• UniProt ID: Q8NHU0