Recombinant Full Length Human CSTF3 Protein, GST-tagged

Cat.No. : CSTF3-2253HF
Product Overview : Human CSTF3 full-length ORF ( AAH09792, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 103 amino acids
Description : The protein encoded by this gene is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The encoded protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.07 kDa
AA Sequence : MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CSTF3 cleavage stimulation factor, 3 pre-RNA, subunit 3, 77kDa [ Homo sapiens ]
Official Symbol CSTF3
Synonyms CSTF3; cleavage stimulation factor, 3 pre-RNA, subunit 3, 77kDa; cleavage stimulation factor, 3 pre RNA, subunit 3, 77kD; cleavage stimulation factor subunit 3; CstF 77; CF-1 77 kDa subunit; CSTF 77 kDa subunit; cleavage stimulation factor 77 kDa subunit; cleavage stimulation factor subunit 3, isoform 1; CSTF-77; MGC43001; MGC75122; MGC117398
Gene ID 1479
mRNA Refseq NM_001033505
Protein Refseq NP_001028677
MIM 600367
UniProt ID Q12996

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CSTF3 Products

Required fields are marked with *

My Review for All CSTF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon