Recombinant Full Length Human CST8 Protein, GST-tagged
Cat.No. : | CST8-2241HF |
Product Overview : | Human CST8 full-length ORF ( AAH69536.1, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 90 amino acids |
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to type 2 cystatins. The encoded protein exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Molecular Mass : | 36.8 kDa |
AA Sequence : | MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CST8 cystatin 8 (cystatin-related epididymal specific) [ Homo sapiens ] |
Official Symbol | CST8 |
Synonyms | CST8; cystatin 8 (cystatin-related epididymal specific); cystatin-8; CRES; cystatin-related epididymal-specific; cystatin-related epididymal spermatogenic protein |
Gene ID | 10047 |
mRNA Refseq | NM_005492 |
Protein Refseq | NP_005483 |
MIM | 608683 |
UniProt ID | O60676 |
◆ Recombinant Proteins | ||
CST8-2241HF | Recombinant Full Length Human CST8 Protein, GST-tagged | +Inquiry |
CST8-76H | Recombinant Human CST8, His-tagged | +Inquiry |
Cst8-5417M | Recombinant Mouse Cst8 Protein (Met1-Pro98), N-His tagged | +Inquiry |
CST8-2033H | Recombinant Human CST8 Protein, GST-tagged | +Inquiry |
CST8-667H | Recombinant Human CST8 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST8-7226HCL | Recombinant Human CST8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CST8 Products
Required fields are marked with *
My Review for All CST8 Products
Required fields are marked with *
0
Inquiry Basket