Recombinant Full Length Human CST8 Protein, GST-tagged

• Cat.No.: CST8-2241HF
• Product Overview: Human CST8 full-length ORF ( AAH69536.1, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to type 2 cystatins. The encoded protein exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 36.8 kDa
• Protein length: 90 amino acids
• AA Sequence: MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CST8 cystatin 8 (cystatin-related epididymal specific) [ Homo sapiens ]
• Official Symbol: CST8
• Synonyms: CST8; cystatin 8 (cystatin-related epididymal specific); cystatin-8; CRES; cystatin-related epididymal-specific; cystatin-related epididymal spermatogenic protein
• Gene ID: 10047
• mRNA Refseq: NM_005492
• Protein Refseq: NP_005483
• MIM: 608683
• UniProt ID: O60676