Recombinant Full Length Human CSNK1A1L Protein, GST-tagged

• Cat.No.: CSNK1A1L-2190HF
• Product Overview: Human CSNK1A1L full-length ORF ( AAH28723, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CSNK1A1L (Casein Kinase 1 Alpha 1 Like) is a Protein Coding gene. Among its related pathways are Wnt Signaling Pathway and Pluripotency and Regulation of lipid metabolism Insulin signaling-generic cascades. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CSNK1A1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 62.81 kDa
• Protein length: 337 amino acids
• AA Sequence: MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEEVAVKLESQKVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLKAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CSNK1A1L casein kinase 1, alpha 1-like [ Homo sapiens ]
• Official Symbol: CSNK1A1L
• Synonyms: CSNK1A1L; casein kinase 1, alpha 1-like; casein kinase I isoform alpha-like; MGC33182; CKI-alpha-like; casein kinase I alpha S-like; CK1
• Gene ID: 122011
• mRNA Refseq: NM_145203
• Protein Refseq: NP_660204
• UniProt ID: Q8N752